PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.45IG7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 371aa    MW: 41581.6 Da    PI: 8.7337
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.45IG7genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.88.8e-32154207255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Araip.45IG7 154 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 207
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15151208IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-28152208IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23154207IPR006447Myb domain, plants
PfamPF002492.5E-7155206IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MLTNSLPSIM QTLLASSPPK FQGPDLSLNI SPPCVGVSDS ENNNNLNNNN MNMNMFLSSR  60
KKILYNDIST SSTTSDSGGS SCGSASDLSH ENNNLNLLHH EPTLTLDLNN YHHHHQGLSR  120
SFNNHHHFQP QIYGREFKRS SRVINGVKRS VRAPRMRWTT TLHAHFVHAV QLLGGHERAT  180
PKSVLELMNV KDLTLAHVKS HLQMYRTVKS TDKSTGHGQT DMGLIPMPRI NNVAHLHANN  240
GVSASHDDRP NNLPHPPQNY SQRSWQSSIM EANTNNSRQK PQIGLTDSHT KGYETMVEEH  300
NCGGMSNCMK ENKLDSTPLS SSDELMLDLE FTLGRPNWEK EHQKESSRVE LTLLKCSINL  360
TNHLISLSLK K
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016163164.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A151R6J51e-118A0A151R6J5_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGGLYMA17G36500.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.12e-56G2-like family protein